PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10013059
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 219aa    MW: 24851.3 Da    PI: 6.4525
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10013059genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.48.6e-1599148554
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                  +++rr+++NRe+ArrsR RK++ ++eL   v  L +eN++L ++l++ ++
  Lus10013059  99 RKQRRMISNRESARRSRMRKQKHLDELWSQVVRLRNENHSLLDRLNHVSE 148
                  79****************************************99998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-1695159IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.05997160IPR004827Basic-leucine zipper domain
PfamPF001704.3E-1299149IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.9E-1299172No hitNo description
SuperFamilySSF579596.89E-1399149No hitNo description
CDDcd147025.64E-21100151No hitNo description
PROSITE patternPS000360102117IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MLSFGDHQFA GGLHLLPHEH SFVQDYFPPP HTSVSSARFL HGDTFPVNMH NMSIHDYIIN  60
PSGVHQNNNN NNCNYSPSSL SSSTSDEADE QQVRIIDERK QRRMISNRES ARRSRMRKQK  120
HLDELWSQVV RLRNENHSLL DRLNHVSESH DRVVEENARL KEETSGLRQL LTDLPIGSPY  180
SNESAVLALR ELDDVVRADH HQSSSNDSSI ASSVDLLL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111118RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00389DAPTransfer from AT3G30530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012442613.13e-59PREDICTED: basic leucine zipper 43-like
SwissprotQ9FMC26e-39BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A0D2PWI53e-59A0A0D2PWI5_G
STRINGVIT_01s0010g00930.t011e-55(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16043399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.11e-43basic leucine-zipper 42